Placeholder image of a protein
Icon representing a puzzle

1151: Revisiting Puzzle 96: Collagen

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
October 21, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups

  1. Avatar for Team Germany 21. Team Germany 1 pt. 7,294
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 7,249
  3. Avatar for freefolder 23. freefolder 1 pt. 7,080
  4. Avatar for OU CHEM4923 24. OU CHEM4923 1 pt. 2,437
  5. Avatar for incognito group 25. incognito group 1 pt. 2,437
  1. Avatar for mirjamvandelft 201. mirjamvandelft Lv 1 1 pt. 7,613
  2. Avatar for parsnip 202. parsnip Lv 1 1 pt. 7,613
  3. Avatar for Thebatman012 203. Thebatman012 Lv 1 1 pt. 7,610
  4. Avatar for pawelkusmierczyk 204. pawelkusmierczyk Lv 1 1 pt. 7,599
  5. Avatar for Hecton015 205. Hecton015 Lv 1 1 pt. 7,597
  6. Avatar for JinniaFlyer450 206. JinniaFlyer450 Lv 1 1 pt. 7,588
  7. Avatar for cnhrcolemam 207. cnhrcolemam Lv 1 1 pt. 7,584
  8. Avatar for The_Riddler 208. The_Riddler Lv 1 1 pt. 7,584
  9. Avatar for martinf 209. martinf Lv 1 1 pt. 7,559
  10. Avatar for lzhchild 210. lzhchild Lv 1 1 pt. 7,559

Comments