Placeholder image of a protein
Icon representing a puzzle

1151: Revisiting Puzzle 96: Collagen

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
October 21, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups


  1. Avatar for Team Germany 21. Team Germany 1 pt. 7,294
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 7,249
  3. Avatar for freefolder 23. freefolder 1 pt. 7,080
  4. Avatar for OU CHEM4923 24. OU CHEM4923 1 pt. 2,437
  5. Avatar for incognito group 25. incognito group 1 pt. 2,437

  1. Avatar for traal 211. traal Lv 1 1 pt. 7,550
  2. Avatar for boondog 212. boondog Lv 1 1 pt. 7,522
  3. Avatar for Lauche2015 213. Lauche2015 Lv 1 1 pt. 7,512
  4. Avatar for jgbryan 214. jgbryan Lv 1 1 pt. 7,508
  5. Avatar for mcas 215. mcas Lv 1 1 pt. 7,504
  6. Avatar for jweethee 216. jweethee Lv 1 1 pt. 7,485
  7. Avatar for irenagrocka 217. irenagrocka Lv 1 1 pt. 7,479
  8. Avatar for R-Structure 218. R-Structure Lv 1 1 pt. 7,479
  9. Avatar for Akatosh 219. Akatosh Lv 1 1 pt. 7,459
  10. Avatar for StephDC 220. StephDC Lv 1 1 pt. 7,442

Comments