Placeholder image of a protein
Icon representing a puzzle

1151: Revisiting Puzzle 96: Collagen

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
October 21, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups

  1. Avatar for Team Germany 21. Team Germany 1 pt. 7,294
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 7,249
  3. Avatar for freefolder 23. freefolder 1 pt. 7,080
  4. Avatar for OU CHEM4923 24. OU CHEM4923 1 pt. 2,437
  5. Avatar for incognito group 25. incognito group 1 pt. 2,437
  1. Avatar for Jaco van As 221. Jaco van As Lv 1 1 pt. 7,439
  2. Avatar for minkim2015 222. minkim2015 Lv 1 1 pt. 7,439
  3. Avatar for fabiodavilla 223. fabiodavilla Lv 1 1 pt. 7,428
  4. Avatar for agnairt 224. agnairt Lv 1 1 pt. 7,426
  5. Avatar for tryedward 225. tryedward Lv 1 1 pt. 7,426
  6. Avatar for xtek23x 226. xtek23x Lv 1 1 pt. 7,424
  7. Avatar for kyubu1 227. kyubu1 Lv 1 1 pt. 7,419
  8. Avatar for soyjesusortiz 228. soyjesusortiz Lv 1 1 pt. 7,417
  9. Avatar for benderm 229. benderm Lv 1 1 pt. 7,399
  10. Avatar for otong1 230. otong1 Lv 1 1 pt. 7,390

Comments