Placeholder image of a protein
Icon representing a puzzle

1151: Revisiting Puzzle 96: Collagen

Closed since over 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary

Created
October 21, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups

  1. Avatar for Team Germany 21. Team Germany 1 pt. 7,294
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 7,249
  3. Avatar for freefolder 23. freefolder 1 pt. 7,080
  4. Avatar for OU CHEM4923 24. OU CHEM4923 1 pt. 2,437
  5. Avatar for incognito group 25. incognito group 1 pt. 2,437
  1. Avatar for zzl 241. zzl Lv 1 1 pt. 7,310
  2. Avatar for AleXusher 242. AleXusher Lv 1 1 pt. 7,294
  3. Avatar for ExhibitionPro 243. ExhibitionPro Lv 1 1 pt. 7,256
  4. Avatar for aspadistra 244. aspadistra Lv 1 1 pt. 7,249
  5. Avatar for Erika Carrillo 245. Erika Carrillo Lv 1 1 pt. 7,206
  6. Avatar for Faszfely 246. Faszfely Lv 1 1 pt. 7,200
  7. Avatar for u.r.i.e.l10 247. u.r.i.e.l10 Lv 1 1 pt. 7,128
  8. Avatar for braulioecr 248. braulioecr Lv 1 1 pt. 7,087
  9. Avatar for Altercomp 249. Altercomp Lv 1 1 pt. 7,080
  10. Avatar for duncavid 250. duncavid Lv 1 1 pt. 7,058

Comments