Placeholder image of a protein
Icon representing a puzzle

1151: Revisiting Puzzle 96: Collagen

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
October 21, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups

  1. Avatar for Team Germany 21. Team Germany 1 pt. 7,294
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 7,249
  3. Avatar for freefolder 23. freefolder 1 pt. 7,080
  4. Avatar for OU CHEM4923 24. OU CHEM4923 1 pt. 2,437
  5. Avatar for incognito group 25. incognito group 1 pt. 2,437
  1. Avatar for blakitachi00 251. blakitachi00 Lv 1 1 pt. 7,049
  2. Avatar for Aldrovanda 252. Aldrovanda Lv 1 1 pt. 6,957
  3. Avatar for phi16 253. phi16 Lv 1 1 pt. 6,923
  4. Avatar for Igorogi 254. Igorogi Lv 1 1 pt. 6,893
  5. Avatar for Hongmiao Hu 255. Hongmiao Hu Lv 1 1 pt. 6,887
  6. Avatar for velvetzb 256. velvetzb Lv 1 1 pt. 6,822
  7. Avatar for EricTs 257. EricTs Lv 1 1 pt. 6,779
  8. Avatar for vagobe 258. vagobe Lv 1 1 pt. 6,731
  9. Avatar for Lub 259. Lub Lv 1 1 pt. 6,726
  10. Avatar for Chulzbabes 260. Chulzbabes Lv 1 1 pt. 6,568

Comments