Placeholder image of a protein
Icon representing a puzzle

1151: Revisiting Puzzle 96: Collagen

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
October 21, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups


  1. Avatar for Team Germany 21. Team Germany 1 pt. 7,294
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 7,249
  3. Avatar for freefolder 23. freefolder 1 pt. 7,080
  4. Avatar for OU CHEM4923 24. OU CHEM4923 1 pt. 2,437
  5. Avatar for incognito group 25. incognito group 1 pt. 2,437

  1. Avatar for Mark- 21. Mark- Lv 1 69 pts. 9,212
  2. Avatar for christioanchauvin 22. christioanchauvin Lv 1 68 pts. 9,209
  3. Avatar for bertro 23. bertro Lv 1 66 pts. 9,150
  4. Avatar for pvc78 24. pvc78 Lv 1 65 pts. 9,149
  5. Avatar for WarpSpeed 25. WarpSpeed Lv 1 64 pts. 9,148
  6. Avatar for frood66 26. frood66 Lv 1 63 pts. 9,148
  7. Avatar for Skippysk8s 27. Skippysk8s Lv 1 61 pts. 9,145
  8. Avatar for WonkyDonkey 28. WonkyDonkey Lv 1 60 pts. 9,129
  9. Avatar for O Seki To 29. O Seki To Lv 1 59 pts. 9,122
  10. Avatar for gloverd 30. gloverd Lv 1 58 pts. 9,120

Comments