Placeholder image of a protein
Icon representing a puzzle

1151: Revisiting Puzzle 96: Collagen

Closed since over 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
October 21, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups


  1. Avatar for Team Germany 21. Team Germany 1 pt. 7,294
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 7,249
  3. Avatar for freefolder 23. freefolder 1 pt. 7,080
  4. Avatar for OU CHEM4923 24. OU CHEM4923 1 pt. 2,437
  5. Avatar for incognito group 25. incognito group 1 pt. 2,437

  1. Avatar for aznarog 41. aznarog Lv 1 46 pts. 9,053
  2. Avatar for sheerbliss 42. sheerbliss Lv 1 45 pts. 9,043
  3. Avatar for Bletchley Park 43. Bletchley Park Lv 1 44 pts. 9,036
  4. Avatar for uhuuhu 44. uhuuhu Lv 1 43 pts. 9,035
  5. Avatar for Anfinsen_slept_here 45. Anfinsen_slept_here Lv 1 42 pts. 9,028
  6. Avatar for joremen 46. joremen Lv 1 41 pts. 9,028
  7. Avatar for Deleted player 47. Deleted player 41 pts. 9,025
  8. Avatar for diamond_dust 48. diamond_dust Lv 1 40 pts. 9,014
  9. Avatar for pmdpmd 49. pmdpmd Lv 1 39 pts. 9,006
  10. Avatar for caglar 50. caglar Lv 1 38 pts. 9,002

Comments