Placeholder image of a protein
Icon representing a puzzle

1151: Revisiting Puzzle 96: Collagen

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
October 21, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups

  1. Avatar for Team Germany 21. Team Germany 1 pt. 7,294
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 7,249
  3. Avatar for freefolder 23. freefolder 1 pt. 7,080
  4. Avatar for OU CHEM4923 24. OU CHEM4923 1 pt. 2,437
  5. Avatar for incognito group 25. incognito group 1 pt. 2,437
  1. Avatar for jermainiac 51. jermainiac Lv 1 37 pts. 8,989
  2. Avatar for silverberg 52. silverberg Lv 1 36 pts. 8,984
  3. Avatar for jobo0502 53. jobo0502 Lv 1 36 pts. 8,980
  4. Avatar for Museka 54. Museka Lv 1 35 pts. 8,974
  5. Avatar for Mr_Jolty 55. Mr_Jolty Lv 1 34 pts. 8,964
  6. Avatar for ecali 56. ecali Lv 1 33 pts. 8,962
  7. Avatar for martin.szew 57. martin.szew Lv 1 33 pts. 8,962
  8. Avatar for NameChangeNeeded01 58. NameChangeNeeded01 Lv 1 32 pts. 8,955
  9. Avatar for Hiro Protagonist 59. Hiro Protagonist Lv 1 31 pts. 8,952
  10. Avatar for Idiotboy 60. Idiotboy Lv 1 30 pts. 8,949

Comments