1151: Revisiting Puzzle 96: Collagen

Closed since over 10 years ago

Summary

• Created: October 21, 2015
• Expires: October 28, 2015 at 11:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups

• 1. Contenders 100 pts. 9,385
• 2. Go Science 81 pts. 9,380
• 3. Gargleblasters 65 pts. 9,343
• 4. Beta Folders 52 pts. 9,341
• 5. Anthropic Dreams 41 pts. 9,300
• 6. Void Crushers 32 pts. 9,258
• 7. HMT heritage 24 pts. 9,242
• 8. L'Alliance Francophone 18 pts. 9,209
• 9. Italiani Al Lavoro 14 pts. 9,120
• 10. Deleted group pts. 9,028

Top soloists

• 31. deLaCeiba 57 pts. 9,120
• 32. shettler 55 pts. 9,116
• 33. cbwest 54 pts. 9,110
• 34. dcrwheeler 53 pts. 9,108
• 35. eusair 52 pts. 9,082
• 36. manu8170 51 pts. 9,080
• 37. gurch 50 pts. 9,074
• 38. egran48 49 pts. 9,071
• 39. TomTaylor 48 pts. 9,069
• 40. Satina 47 pts. 9,065