Placeholder image of a protein
Icon representing a puzzle

1153: Revisiting Puzzle 97: Pig

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
October 27, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 8 pts. 9,544
  2. Avatar for Russian team 12. Russian team 6 pts. 9,179
  3. Avatar for Natural Abilities 13. Natural Abilities 4 pts. 9,113
  4. Avatar for Deleted group 14. Deleted group pts. 8,822
  5. Avatar for xkcd 15. xkcd 2 pts. 8,746
  6. Avatar for BOINC@Poland 16. BOINC@Poland 2 pts. 8,650
  7. Avatar for Eὕρηκα! Heureka! 17. Eὕρηκα! Heureka! 1 pt. 8,385
  8. Avatar for ASD folders 18. ASD folders 1 pt. 7,905
  9. Avatar for Hamber 2-2 1 19. Hamber 2-2 1 1 pt. 7,738
  10. Avatar for Mr. Baxley's Students 20. Mr. Baxley's Students 1 pt. 7,718
  1. Avatar for Festering Wounds 91. Festering Wounds Lv 1 12 pts. 9,087
  2. Avatar for BeImmie 92. BeImmie Lv 1 12 pts. 9,059
  3. Avatar for Terafold 93. Terafold Lv 1 12 pts. 9,055
  4. Avatar for Satina 94. Satina Lv 1 11 pts. 9,051
  5. Avatar for Jajaboman 95. Jajaboman Lv 1 11 pts. 9,050
  6. Avatar for jamiexq 96. jamiexq Lv 1 11 pts. 9,042
  7. Avatar for hansvandenhof 97. hansvandenhof Lv 1 10 pts. 9,039
  8. Avatar for dbuske 98. dbuske Lv 1 10 pts. 9,032
  9. Avatar for ViJay7019 99. ViJay7019 Lv 1 10 pts. 9,014
  10. Avatar for dak3910 100. dak3910 Lv 1 10 pts. 9,006

Comments