Placeholder image of a protein
Icon representing a puzzle

1153: Revisiting Puzzle 97: Pig

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
October 27, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,903
  2. Avatar for Beta Folders 2. Beta Folders 82 pts. 9,865
  3. Avatar for Go Science 3. Go Science 66 pts. 9,864
  4. Avatar for Contenders 4. Contenders 53 pts. 9,831
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 42 pts. 9,771
  6. Avatar for Gargleblasters 6. Gargleblasters 33 pts. 9,735
  7. Avatar for FoldIt@Netherlands 7. FoldIt@Netherlands 26 pts. 9,700
  8. Avatar for Void Crushers 8. Void Crushers 20 pts. 9,684
  9. Avatar for HMT heritage 9. HMT heritage 15 pts. 9,664
  10. Avatar for Deleted group 10. Deleted group pts. 9,572
  1. Avatar for Festering Wounds 91. Festering Wounds Lv 1 12 pts. 9,087
  2. Avatar for BeImmie 92. BeImmie Lv 1 12 pts. 9,059
  3. Avatar for Terafold 93. Terafold Lv 1 12 pts. 9,055
  4. Avatar for Satina 94. Satina Lv 1 11 pts. 9,051
  5. Avatar for Jajaboman 95. Jajaboman Lv 1 11 pts. 9,050
  6. Avatar for jamiexq 96. jamiexq Lv 1 11 pts. 9,042
  7. Avatar for hansvandenhof 97. hansvandenhof Lv 1 10 pts. 9,039
  8. Avatar for dbuske 98. dbuske Lv 1 10 pts. 9,032
  9. Avatar for ViJay7019 99. ViJay7019 Lv 1 10 pts. 9,014
  10. Avatar for dak3910 100. dak3910 Lv 1 10 pts. 9,006

Comments