Placeholder image of a protein
Icon representing a puzzle

1153: Revisiting Puzzle 97: Pig

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
October 27, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 8 pts. 9,544
  2. Avatar for Russian team 12. Russian team 6 pts. 9,179
  3. Avatar for Natural Abilities 13. Natural Abilities 4 pts. 9,113
  4. Avatar for Deleted group 14. Deleted group pts. 8,822
  5. Avatar for xkcd 15. xkcd 2 pts. 8,746
  6. Avatar for BOINC@Poland 16. BOINC@Poland 2 pts. 8,650
  7. Avatar for Eὕρηκα! Heureka! 17. Eὕρηκα! Heureka! 1 pt. 8,385
  8. Avatar for ASD folders 18. ASD folders 1 pt. 7,905
  9. Avatar for Hamber 2-2 1 19. Hamber 2-2 1 1 pt. 7,738
  10. Avatar for Mr. Baxley's Students 20. Mr. Baxley's Students 1 pt. 7,718
  1. Avatar for rezaefar 171. rezaefar Lv 1 1 pt. 8,235
  2. Avatar for tela 172. tela Lv 1 1 pt. 8,212
  3. Avatar for navn 173. navn Lv 1 1 pt. 8,162
  4. Avatar for Arne Heessels 174. Arne Heessels Lv 1 1 pt. 8,132
  5. Avatar for mirjamvandelft 175. mirjamvandelft Lv 1 1 pt. 8,130
  6. Avatar for ivalnic 176. ivalnic Lv 1 1 pt. 8,111
  7. Avatar for scubasteve1721 177. scubasteve1721 Lv 1 1 pt. 8,099
  8. Avatar for Mike Cassidy 178. Mike Cassidy Lv 1 1 pt. 8,086
  9. Avatar for martinf 179. martinf Lv 1 1 pt. 8,078
  10. Avatar for Sydefecks 180. Sydefecks Lv 1 1 pt. 8,076

Comments