Placeholder image of a protein
Icon representing a puzzle

1153: Revisiting Puzzle 97: Pig

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
October 27, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,903
  2. Avatar for Beta Folders 2. Beta Folders 82 pts. 9,865
  3. Avatar for Go Science 3. Go Science 66 pts. 9,864
  4. Avatar for Contenders 4. Contenders 53 pts. 9,831
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 42 pts. 9,771
  6. Avatar for Gargleblasters 6. Gargleblasters 33 pts. 9,735
  7. Avatar for FoldIt@Netherlands 7. FoldIt@Netherlands 26 pts. 9,700
  8. Avatar for Void Crushers 8. Void Crushers 20 pts. 9,684
  9. Avatar for HMT heritage 9. HMT heritage 15 pts. 9,664
  10. Avatar for Deleted group 10. Deleted group pts. 9,572
  1. Avatar for rezaefar 171. rezaefar Lv 1 1 pt. 8,235
  2. Avatar for tela 172. tela Lv 1 1 pt. 8,212
  3. Avatar for navn 173. navn Lv 1 1 pt. 8,162
  4. Avatar for Arne Heessels 174. Arne Heessels Lv 1 1 pt. 8,132
  5. Avatar for mirjamvandelft 175. mirjamvandelft Lv 1 1 pt. 8,130
  6. Avatar for ivalnic 176. ivalnic Lv 1 1 pt. 8,111
  7. Avatar for scubasteve1721 177. scubasteve1721 Lv 1 1 pt. 8,099
  8. Avatar for Mike Cassidy 178. Mike Cassidy Lv 1 1 pt. 8,086
  9. Avatar for martinf 179. martinf Lv 1 1 pt. 8,078
  10. Avatar for Sydefecks 180. Sydefecks Lv 1 1 pt. 8,076

Comments