Placeholder image of a protein
Icon representing a puzzle

1153: Revisiting Puzzle 97: Pig

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
October 27, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for EVHS AP Biology 21. EVHS AP Biology 1 pt. 7,633
  2. Avatar for Czech National Team 22. Czech National Team 1 pt. 7,576
  3. Avatar for DSN @ Home 23. DSN @ Home 1 pt. 7,573
  4. Avatar for Alpha Folders 24. Alpha Folders 1 pt. 7,530
  5. Avatar for CureCoin 25. CureCoin 1 pt. 7,425
  6. Avatar for ricg test group 26. ricg test group 1 pt. 4,651
  1. Avatar for brgreening 161. brgreening Lv 1 1 pt. 8,335
  2. Avatar for rinze 162. rinze Lv 1 1 pt. 8,320
  3. Avatar for RyeSnake 163. RyeSnake Lv 1 1 pt. 8,298
  4. Avatar for pandabearsecond 164. pandabearsecond Lv 1 1 pt. 8,298
  5. Avatar for Wheeler22 165. Wheeler22 Lv 1 1 pt. 8,297
  6. Avatar for Vincenzo Brancaccio 166. Vincenzo Brancaccio Lv 1 1 pt. 8,288
  7. Avatar for forest124124 167. forest124124 Lv 1 1 pt. 8,268
  8. Avatar for a5hm0r 168. a5hm0r Lv 1 1 pt. 8,261
  9. Avatar for Psych0Active 169. Psych0Active Lv 1 1 pt. 8,254
  10. Avatar for girltano 170. girltano Lv 1 1 pt. 8,246

Comments