Placeholder image of a protein
Icon representing a puzzle

1153: Revisiting Puzzle 97: Pig

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
October 27, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,903
  2. Avatar for Beta Folders 2. Beta Folders 82 pts. 9,865
  3. Avatar for Go Science 3. Go Science 66 pts. 9,864
  4. Avatar for Contenders 4. Contenders 53 pts. 9,831
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 42 pts. 9,771
  6. Avatar for Gargleblasters 6. Gargleblasters 33 pts. 9,735
  7. Avatar for FoldIt@Netherlands 7. FoldIt@Netherlands 26 pts. 9,700
  8. Avatar for Void Crushers 8. Void Crushers 20 pts. 9,684
  9. Avatar for HMT heritage 9. HMT heritage 15 pts. 9,664
  10. Avatar for Deleted group 10. Deleted group pts. 9,572
  1. Avatar for brgreening 161. brgreening Lv 1 1 pt. 8,335
  2. Avatar for rinze 162. rinze Lv 1 1 pt. 8,320
  3. Avatar for RyeSnake 163. RyeSnake Lv 1 1 pt. 8,298
  4. Avatar for pandabearsecond 164. pandabearsecond Lv 1 1 pt. 8,298
  5. Avatar for Wheeler22 165. Wheeler22 Lv 1 1 pt. 8,297
  6. Avatar for Vincenzo Brancaccio 166. Vincenzo Brancaccio Lv 1 1 pt. 8,288
  7. Avatar for forest124124 167. forest124124 Lv 1 1 pt. 8,268
  8. Avatar for a5hm0r 168. a5hm0r Lv 1 1 pt. 8,261
  9. Avatar for Psych0Active 169. Psych0Active Lv 1 1 pt. 8,254
  10. Avatar for girltano 170. girltano Lv 1 1 pt. 8,246

Comments