Placeholder image of a protein
Icon representing a puzzle

1153: Revisiting Puzzle 97: Pig

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
October 27, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for EVHS AP Biology 21. EVHS AP Biology 1 pt. 7,633
  2. Avatar for Czech National Team 22. Czech National Team 1 pt. 7,576
  3. Avatar for DSN @ Home 23. DSN @ Home 1 pt. 7,573
  4. Avatar for Alpha Folders 24. Alpha Folders 1 pt. 7,530
  5. Avatar for CureCoin 25. CureCoin 1 pt. 7,425
  6. Avatar for ricg test group 26. ricg test group 1 pt. 4,651
  1. Avatar for Blackhawk91 241. Blackhawk91 Lv 1 1 pt. 7,370
  2. Avatar for NameChangeNeeded01 242. NameChangeNeeded01 Lv 1 1 pt. 7,301
  3. Avatar for Cinamontoast 243. Cinamontoast Lv 1 1 pt. 7,298
  4. Avatar for scout89898 244. scout89898 Lv 1 1 pt. 7,292
  5. Avatar for Johnnywiki 245. Johnnywiki Lv 1 1 pt. 7,289
  6. Avatar for Dantoto 246. Dantoto Lv 1 1 pt. 7,249
  7. Avatar for mukmu 247. mukmu Lv 1 1 pt. 7,226
  8. Avatar for redrubi 248. redrubi Lv 1 1 pt. 7,001
  9. Avatar for Scopper 249. Scopper Lv 1 1 pt. 6,820
  10. Avatar for Dmitry Gavriley 250. Dmitry Gavriley Lv 1 1 pt. 6,599

Comments