Placeholder image of a protein
Icon representing a puzzle

1153: Revisiting Puzzle 97: Pig

Closed since over 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
October 27, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,903
  2. Avatar for Beta Folders 2. Beta Folders 82 pts. 9,865
  3. Avatar for Go Science 3. Go Science 66 pts. 9,864
  4. Avatar for Contenders 4. Contenders 53 pts. 9,831
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 42 pts. 9,771
  6. Avatar for Gargleblasters 6. Gargleblasters 33 pts. 9,735
  7. Avatar for FoldIt@Netherlands 7. FoldIt@Netherlands 26 pts. 9,700
  8. Avatar for Void Crushers 8. Void Crushers 20 pts. 9,684
  9. Avatar for HMT heritage 9. HMT heritage 15 pts. 9,664
  10. Avatar for Deleted group 10. Deleted group pts. 9,572

  1. Avatar for lamoille 131. lamoille Lv 1 4 pts. 8,668
  2. Avatar for GreekCivilization 132. GreekCivilization Lv 1 4 pts. 8,665
  3. Avatar for Sci1217 133. Sci1217 Lv 1 3 pts. 8,658
  4. Avatar for kitek314_pl 134. kitek314_pl Lv 1 3 pts. 8,650
  5. Avatar for weitzen 135. weitzen Lv 1 3 pts. 8,643
  6. Avatar for mitarcher 136. mitarcher Lv 1 3 pts. 8,639
  7. Avatar for dnpw1 137. dnpw1 Lv 1 3 pts. 8,628
  8. Avatar for Deleted player 138. Deleted player 3 pts. 8,582
  9. Avatar for pizpot 139. pizpot Lv 1 3 pts. 8,566
  10. Avatar for harvardman 140. harvardman Lv 1 3 pts. 8,564

Comments