Placeholder image of a protein
Icon representing a puzzle

1156: Revisiting Puzzle 110: Turkey

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
November 11, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 9 pts. 9,022
  2. Avatar for xkcd 12. xkcd 7 pts. 8,892
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 5 pts. 8,696
  4. Avatar for Natural Abilities 14. Natural Abilities 4 pts. 8,599
  5. Avatar for It's over 9000! 15. It's over 9000! 3 pts. 8,557
  6. Avatar for Deleted group 16. Deleted group pts. 8,489
  7. Avatar for Russian team 17. Russian team 1 pt. 8,374
  8. Avatar for Minions of TWIS 18. Minions of TWIS 1 pt. 8,354
  9. Avatar for Deleted group 19. Deleted group pts. 8,345
  10. Avatar for Czech National Team 20. Czech National Team 1 pt. 8,068
  1. Avatar for steveB 91. steveB Lv 1 13 pts. 8,920
  2. Avatar for fishercat 92. fishercat Lv 1 13 pts. 8,915
  3. Avatar for stomjoh 93. stomjoh Lv 1 12 pts. 8,907
  4. Avatar for DaSupaFolda 94. DaSupaFolda Lv 1 12 pts. 8,897
  5. Avatar for fryguy 95. fryguy Lv 1 12 pts. 8,892
  6. Avatar for arginia 96. arginia Lv 1 11 pts. 8,879
  7. Avatar for dbuske 97. dbuske Lv 1 11 pts. 8,879
  8. Avatar for rezaefar 98. rezaefar Lv 1 11 pts. 8,875
  9. Avatar for Exonx 99. Exonx Lv 1 10 pts. 8,871
  10. Avatar for Radeodem8 100. Radeodem8 Lv 1 10 pts. 8,871

Comments