Placeholder image of a protein
Icon representing a puzzle

1156: Revisiting Puzzle 110: Turkey

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
November 11, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 9 pts. 9,022
  2. Avatar for xkcd 12. xkcd 7 pts. 8,892
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 5 pts. 8,696
  4. Avatar for Natural Abilities 14. Natural Abilities 4 pts. 8,599
  5. Avatar for It's over 9000! 15. It's over 9000! 3 pts. 8,557
  6. Avatar for Deleted group 16. Deleted group pts. 8,489
  7. Avatar for Russian team 17. Russian team 1 pt. 8,374
  8. Avatar for Minions of TWIS 18. Minions of TWIS 1 pt. 8,354
  9. Avatar for Deleted group 19. Deleted group pts. 8,345
  10. Avatar for Czech National Team 20. Czech National Team 1 pt. 8,068
  1. Avatar for Petrifolder 121. Petrifolder Lv 1 5 pts. 8,737
  2. Avatar for Vinara 122. Vinara Lv 1 5 pts. 8,734
  3. Avatar for pizpot 123. pizpot Lv 1 5 pts. 8,728
  4. Avatar for TJOK fan 124. TJOK fan Lv 1 5 pts. 8,715
  5. Avatar for ViJay7019 125. ViJay7019 Lv 1 5 pts. 8,712
  6. Avatar for rinze 126. rinze Lv 1 5 pts. 8,709
  7. Avatar for DScott 127. DScott Lv 1 4 pts. 8,704
  8. Avatar for Pro Lapser 128. Pro Lapser Lv 1 4 pts. 8,700
  9. Avatar for manu8170 129. manu8170 Lv 1 4 pts. 8,699
  10. Avatar for GreekCivilization 130. GreekCivilization Lv 1 4 pts. 8,698

Comments