Placeholder image of a protein
Icon representing a puzzle

1156: Revisiting Puzzle 110: Turkey

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
November 11, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 9 pts. 9,022
  2. Avatar for xkcd 12. xkcd 7 pts. 8,892
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 5 pts. 8,696
  4. Avatar for Natural Abilities 14. Natural Abilities 4 pts. 8,599
  5. Avatar for It's over 9000! 15. It's over 9000! 3 pts. 8,557
  6. Avatar for Deleted group 16. Deleted group pts. 8,489
  7. Avatar for Russian team 17. Russian team 1 pt. 8,374
  8. Avatar for Minions of TWIS 18. Minions of TWIS 1 pt. 8,354
  9. Avatar for Deleted group 19. Deleted group pts. 8,345
  10. Avatar for Czech National Team 20. Czech National Team 1 pt. 8,068
  1. Avatar for reefyrob 41. reefyrob Lv 1 45 pts. 9,120
  2. Avatar for hpaege 42. hpaege Lv 1 44 pts. 9,116
  3. Avatar for actiasluna 43. actiasluna Lv 1 43 pts. 9,110
  4. Avatar for Norrjane 44. Norrjane Lv 1 42 pts. 9,110
  5. Avatar for WonkyDonkey 45. WonkyDonkey Lv 1 41 pts. 9,109
  6. Avatar for mimi 46. mimi Lv 1 40 pts. 9,105
  7. Avatar for shettler 47. shettler Lv 1 39 pts. 9,105
  8. Avatar for froggs554 48. froggs554 Lv 1 38 pts. 9,104
  9. Avatar for cobaltteal 49. cobaltteal Lv 1 37 pts. 9,098
  10. Avatar for silverberg 50. silverberg Lv 1 36 pts. 9,092

Comments