Placeholder image of a protein
Icon representing a puzzle

1156: Revisiting Puzzle 110: Turkey

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
November 11, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 9 pts. 9,022
  2. Avatar for xkcd 12. xkcd 7 pts. 8,892
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 5 pts. 8,696
  4. Avatar for Natural Abilities 14. Natural Abilities 4 pts. 8,599
  5. Avatar for It's over 9000! 15. It's over 9000! 3 pts. 8,557
  6. Avatar for Deleted group 16. Deleted group pts. 8,489
  7. Avatar for Russian team 17. Russian team 1 pt. 8,374
  8. Avatar for Minions of TWIS 18. Minions of TWIS 1 pt. 8,354
  9. Avatar for Deleted group 19. Deleted group pts. 8,345
  10. Avatar for Czech National Team 20. Czech National Team 1 pt. 8,068
  1. Avatar for jermainiac 61. jermainiac Lv 1 28 pts. 9,054
  2. Avatar for WBarme1234 62. WBarme1234 Lv 1 28 pts. 9,053
  3. Avatar for ponderosa 63. ponderosa Lv 1 27 pts. 9,043
  4. Avatar for pvc78 64. pvc78 Lv 1 26 pts. 9,043
  5. Avatar for hansvandenhof 65. hansvandenhof Lv 1 26 pts. 9,042
  6. Avatar for egran48 66. egran48 Lv 1 25 pts. 9,041
  7. Avatar for hada 67. hada Lv 1 24 pts. 9,041
  8. Avatar for Idiotboy 68. Idiotboy Lv 1 24 pts. 9,038
  9. Avatar for kitek314_pl 69. kitek314_pl Lv 1 23 pts. 9,037
  10. Avatar for joremen 70. joremen Lv 1 23 pts. 9,035

Comments