Placeholder image of a protein
Icon representing a puzzle

1156: Revisiting Puzzle 110: Turkey

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
November 11, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 9 pts. 9,022
  2. Avatar for xkcd 12. xkcd 7 pts. 8,892
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 5 pts. 8,696
  4. Avatar for Natural Abilities 14. Natural Abilities 4 pts. 8,599
  5. Avatar for It's over 9000! 15. It's over 9000! 3 pts. 8,557
  6. Avatar for Deleted group 16. Deleted group pts. 8,489
  7. Avatar for Russian team 17. Russian team 1 pt. 8,374
  8. Avatar for Minions of TWIS 18. Minions of TWIS 1 pt. 8,354
  9. Avatar for Deleted group 19. Deleted group pts. 8,345
  10. Avatar for Czech National Team 20. Czech National Team 1 pt. 8,068
  1. Avatar for Glen B 71. Glen B Lv 1 22 pts. 9,034
  2. Avatar for gurch 72. gurch Lv 1 22 pts. 9,031
  3. Avatar for Bushman 73. Bushman Lv 1 21 pts. 9,022
  4. Avatar for MaartenDesnouck 74. MaartenDesnouck Lv 1 20 pts. 9,020
  5. Avatar for abiogenesis 75. abiogenesis Lv 1 20 pts. 9,015
  6. Avatar for decbin 76. decbin Lv 1 19 pts. 9,010
  7. Avatar for caglar 77. caglar Lv 1 19 pts. 9,004
  8. Avatar for uhuuhu 78. uhuuhu Lv 1 18 pts. 8,975
  9. Avatar for Iron pet 79. Iron pet Lv 1 18 pts. 8,970
  10. Avatar for Terafold 80. Terafold Lv 1 18 pts. 8,963

Comments