frood66 Lv 1
perhaps this should be 1158.
1158: Revisiting Puzzle 111: Mouse
Closed since over 10 years ago
Intermediate Overall PredictionSummary
- Created
- November 18, 2015
- Expires
- Max points
- 100
This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ
