Placeholder image of a protein
Icon representing a puzzle

1158: Revisiting Puzzle 111: Mouse

Closed since over 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
November 18, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups


  1. Avatar for Beta Folders 100 pts. 8,919
  2. Avatar for Go Science 2. Go Science 81 pts. 8,915
  3. Avatar for Void Crushers 3. Void Crushers 65 pts. 8,910
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 52 pts. 8,906
  5. Avatar for Gargleblasters 5. Gargleblasters 41 pts. 8,896
  6. Avatar for Italiani Al Lavoro 6. Italiani Al Lavoro 32 pts. 8,880
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 24 pts. 8,870
  8. Avatar for HMT heritage 8. HMT heritage 18 pts. 8,866
  9. Avatar for Contenders 9. Contenders 14 pts. 8,859
  10. Avatar for Deleted group 10. Deleted group pts. 8,824

  1. Avatar for WonkyDonkey 21. WonkyDonkey Lv 1 70 pts. 8,878
  2. Avatar for cbwest 22. cbwest Lv 1 68 pts. 8,874
  3. Avatar for Vredeman 23. Vredeman Lv 1 67 pts. 8,874
  4. Avatar for martin.szew 24. martin.szew Lv 1 66 pts. 8,873
  5. Avatar for aznarog 25. aznarog Lv 1 64 pts. 8,870
  6. Avatar for Blipperman 26. Blipperman Lv 1 63 pts. 8,868
  7. Avatar for pauldunn 27. pauldunn Lv 1 62 pts. 8,867
  8. Avatar for SKSbell 28. SKSbell Lv 1 61 pts. 8,865
  9. Avatar for O Seki To 29. O Seki To Lv 1 60 pts. 8,865
  10. Avatar for pmdpmd 30. pmdpmd Lv 1 59 pts. 8,863

Comments