Placeholder image of a protein
Icon representing a puzzle

1158: Revisiting Puzzle 111: Mouse

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
November 18, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 8,919
  2. Avatar for Go Science 2. Go Science 81 pts. 8,915
  3. Avatar for Void Crushers 3. Void Crushers 65 pts. 8,910
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 52 pts. 8,906
  5. Avatar for Gargleblasters 5. Gargleblasters 41 pts. 8,896
  6. Avatar for Italiani Al Lavoro 6. Italiani Al Lavoro 32 pts. 8,880
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 24 pts. 8,870
  8. Avatar for HMT heritage 8. HMT heritage 18 pts. 8,866
  9. Avatar for Contenders 9. Contenders 14 pts. 8,859
  10. Avatar for Deleted group 10. Deleted group pts. 8,824
  1. Avatar for uhuuhu 31. uhuuhu Lv 1 57 pts. 8,863
  2. Avatar for YeshuaLives 32. YeshuaLives Lv 1 56 pts. 8,862
  3. Avatar for diamond_dust 33. diamond_dust Lv 1 55 pts. 8,860
  4. Avatar for gitwut 34. gitwut Lv 1 54 pts. 8,859
  5. Avatar for Skippysk8s 35. Skippysk8s Lv 1 53 pts. 8,857
  6. Avatar for johnmitch 36. johnmitch Lv 1 52 pts. 8,856
  7. Avatar for smilingone 37. smilingone Lv 1 51 pts. 8,854
  8. Avatar for goastano 38. goastano Lv 1 50 pts. 8,851
  9. Avatar for Jim Fraser 39. Jim Fraser Lv 1 49 pts. 8,846
  10. Avatar for nemo7731 40. nemo7731 Lv 1 48 pts. 8,843

Comments