Placeholder image of a protein
Icon representing a puzzle

1158: Revisiting Puzzle 111: Mouse

Closed since over 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
November 18, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups


  1. Avatar for Beta Folders 100 pts. 8,919
  2. Avatar for Go Science 2. Go Science 81 pts. 8,915
  3. Avatar for Void Crushers 3. Void Crushers 65 pts. 8,910
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 52 pts. 8,906
  5. Avatar for Gargleblasters 5. Gargleblasters 41 pts. 8,896
  6. Avatar for Italiani Al Lavoro 6. Italiani Al Lavoro 32 pts. 8,880
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 24 pts. 8,870
  8. Avatar for HMT heritage 8. HMT heritage 18 pts. 8,866
  9. Avatar for Contenders 9. Contenders 14 pts. 8,859
  10. Avatar for Deleted group 10. Deleted group pts. 8,824

  1. Avatar for ponderosa 51. ponderosa Lv 1 38 pts. 8,824
  2. Avatar for grogar7 52. grogar7 Lv 1 37 pts. 8,824
  3. Avatar for jdormaar 53. jdormaar Lv 1 36 pts. 8,823
  4. Avatar for WarpSpeed 54. WarpSpeed Lv 1 36 pts. 8,816
  5. Avatar for mimi 55. mimi Lv 1 35 pts. 8,814
  6. Avatar for alwen 56. alwen Lv 1 34 pts. 8,812
  7. Avatar for christioanchauvin 57. christioanchauvin Lv 1 33 pts. 8,811
  8. Avatar for silverberg 58. silverberg Lv 1 33 pts. 8,807
  9. Avatar for cobaltteal 59. cobaltteal Lv 1 32 pts. 8,807
  10. Avatar for AryehK 60. AryehK Lv 1 31 pts. 8,807

Comments