Placeholder image of a protein
Icon representing a puzzle

1162: Unsolved De-novo Freestyle 59

Closed since over 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
November 25, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


HVSEEIERIIREVQEEMKKNKGKGTKLKTSTESDGLRINIEIEVRGDNMRIEVKVKVGNVEVEVRTETSF

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,364
  2. Avatar for Contenders 2. Contenders 81 pts. 9,360
  3. Avatar for Gargleblasters 3. Gargleblasters 65 pts. 9,352
  4. Avatar for Void Crushers 4. Void Crushers 52 pts. 9,318
  5. Avatar for Beta Folders 5. Beta Folders 41 pts. 9,288
  6. Avatar for Go Science 6. Go Science 32 pts. 9,282
  7. Avatar for HMT heritage 7. HMT heritage 24 pts. 9,281
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 18 pts. 9,275
  9. Avatar for Deleted group 9. Deleted group pts. 9,039
  10. Avatar for xkcd 10. xkcd 10 pts. 8,850

  1. Avatar for AryehK 101. AryehK Lv 1 12 pts. 8,639
  2. Avatar for PrettyPony2001 102. PrettyPony2001 Lv 1 11 pts. 8,608
  3. Avatar for ViJay7019 103. ViJay7019 Lv 1 11 pts. 8,593
  4. Avatar for weitzen 104. weitzen Lv 1 11 pts. 8,592
  5. Avatar for arginia 105. arginia Lv 1 11 pts. 8,584
  6. Avatar for bamh 106. bamh Lv 1 10 pts. 8,584
  7. Avatar for zo3xiaJonWeinberg 107. zo3xiaJonWeinberg Lv 1 10 pts. 8,580
  8. Avatar for kitek314_pl 108. kitek314_pl Lv 1 10 pts. 8,580
  9. Avatar for Tsskyx 109. Tsskyx Lv 1 9 pts. 8,578
  10. Avatar for georgefield 110. georgefield Lv 1 9 pts. 8,578

Comments