Placeholder image of a protein
Icon representing a puzzle

1162: Unsolved De-novo Freestyle 59

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
November 25, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


HVSEEIERIIREVQEEMKKNKGKGTKLKTSTESDGLRINIEIEVRGDNMRIEVKVKVGNVEVEVRTETSF

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,364
  2. Avatar for Contenders 2. Contenders 81 pts. 9,360
  3. Avatar for Gargleblasters 3. Gargleblasters 65 pts. 9,352
  4. Avatar for Void Crushers 4. Void Crushers 52 pts. 9,318
  5. Avatar for Beta Folders 5. Beta Folders 41 pts. 9,288
  6. Avatar for Go Science 6. Go Science 32 pts. 9,282
  7. Avatar for HMT heritage 7. HMT heritage 24 pts. 9,281
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 18 pts. 9,275
  9. Avatar for Deleted group 9. Deleted group pts. 9,039
  10. Avatar for xkcd 10. xkcd 10 pts. 8,850
  1. Avatar for SKSbell 91. SKSbell Lv 1 15 pts. 8,706
  2. Avatar for joremen 92. joremen Lv 1 15 pts. 8,703
  3. Avatar for JokerES 93. JokerES Lv 1 14 pts. 8,695
  4. Avatar for Czim 94. Czim Lv 1 14 pts. 8,684
  5. Avatar for goastano 95. goastano Lv 1 14 pts. 8,682
  6. Avatar for alwen 96. alwen Lv 1 13 pts. 8,681
  7. Avatar for Vinara 97. Vinara Lv 1 13 pts. 8,673
  8. Avatar for tarimo 98. tarimo Lv 1 13 pts. 8,661
  9. Avatar for JUMELLE54 99. JUMELLE54 Lv 1 12 pts. 8,644
  10. Avatar for ecali 100. ecali Lv 1 12 pts. 8,642

Comments