Placeholder image of a protein
Icon representing a puzzle

1165: Unsolved De-novo Freestyle 60

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
December 03, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


NEEEKIKKRIEEYRKRLSGMRVEIRIGQRVEIEFDGKTELRIHVHRGEEEKIKELLKEIEKVVKN

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 4 pts. 8,800
  2. Avatar for GUGITBIOTECH 12. GUGITBIOTECH 2 pts. 8,725
  3. Avatar for BOINC@Poland 13. BOINC@Poland 2 pts. 8,548
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 8,286
  5. Avatar for Deleted group 15. Deleted group pts. 8,225
  6. Avatar for Natural Abilities 16. Natural Abilities 1 pt. 8,210
  7. Avatar for Deleted group 17. Deleted group pts. 7,796
  8. Avatar for Deleted group 18. Deleted group pts. 6,855
  9. Avatar for NYIT OW BIOL-340 Fall 2015 19. NYIT OW BIOL-340 Fall 2015 1 pt. 6,420
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 6,196
  1. Avatar for retiredmichael
    1. retiredmichael Lv 1
    100 pts. 9,365
  2. Avatar for Deleted player 2. Deleted player pts. 9,269
  3. Avatar for Galaxie 3. Galaxie Lv 1 97 pts. 9,264
  4. Avatar for spvincent 4. spvincent Lv 1 95 pts. 9,257
  5. Avatar for Madde 5. Madde Lv 1 93 pts. 9,254
  6. Avatar for g_b 6. g_b Lv 1 91 pts. 9,248
  7. Avatar for Skippysk8s 7. Skippysk8s Lv 1 89 pts. 9,246
  8. Avatar for nemo7731 8. nemo7731 Lv 1 88 pts. 9,243
  9. Avatar for jermainiac 9. jermainiac Lv 1 86 pts. 9,242
  10. Avatar for LagMasterSam 10. LagMasterSam Lv 1 84 pts. 9,240

Comments