Placeholder image of a protein
Icon representing a puzzle

1165: Unsolved De-novo Freestyle 60

Closed since over 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
December 03, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


NEEEKIKKRIEEYRKRLSGMRVEIRIGQRVEIEFDGKTELRIHVHRGEEEKIKELLKEIEKVVKN

Top groups


  1. Avatar for CureCoin 21. CureCoin 1 pt. 6,136

  1. Avatar for retiredmichael
    1. retiredmichael Lv 1
    100 pts. 9,365
  2. Avatar for Deleted player 2. Deleted player pts. 9,269
  3. Avatar for Galaxie 3. Galaxie Lv 1 97 pts. 9,264
  4. Avatar for spvincent 4. spvincent Lv 1 95 pts. 9,257
  5. Avatar for Madde 5. Madde Lv 1 93 pts. 9,254
  6. Avatar for g_b 6. g_b Lv 1 91 pts. 9,248
  7. Avatar for Skippysk8s 7. Skippysk8s Lv 1 89 pts. 9,246
  8. Avatar for nemo7731 8. nemo7731 Lv 1 88 pts. 9,243
  9. Avatar for jermainiac 9. jermainiac Lv 1 86 pts. 9,242
  10. Avatar for LagMasterSam 10. LagMasterSam Lv 1 84 pts. 9,240

Comments