Placeholder image of a protein
Icon representing a puzzle

1165: Unsolved De-novo Freestyle 60

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
December 03, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


NEEEKIKKRIEEYRKRLSGMRVEIRIGQRVEIEFDGKTELRIHVHRGEEEKIKELLKEIEKVVKN

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 4 pts. 8,800
  2. Avatar for GUGITBIOTECH 12. GUGITBIOTECH 2 pts. 8,725
  3. Avatar for BOINC@Poland 13. BOINC@Poland 2 pts. 8,548
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 8,286
  5. Avatar for Deleted group 15. Deleted group pts. 8,225
  6. Avatar for Natural Abilities 16. Natural Abilities 1 pt. 8,210
  7. Avatar for Deleted group 17. Deleted group pts. 7,796
  8. Avatar for Deleted group 18. Deleted group pts. 6,855
  9. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 6,196

  1. Avatar for bhodg1 131. bhodg1 Lv 1 4 pts. 8,425
  2. Avatar for Xavier Fontanals 132. Xavier Fontanals Lv 1 4 pts. 8,421
  3. Avatar for abiogenesis 133. abiogenesis Lv 1 3 pts. 8,412
  4. Avatar for Scopper 134. Scopper Lv 1 3 pts. 8,411
  5. Avatar for Silhouette 135. Silhouette Lv 1 3 pts. 8,402
  6. Avatar for Paranox 136. Paranox Lv 1 3 pts. 8,401
  7. Avatar for Inkedhands 137. Inkedhands Lv 1 3 pts. 8,389
  8. Avatar for dahast.de 138. dahast.de Lv 1 3 pts. 8,388
  9. Avatar for tela 139. tela Lv 1 3 pts. 8,368
  10. Avatar for icedes 140. icedes Lv 1 3 pts. 8,360

Comments