Placeholder image of a protein
Icon representing a puzzle

1165: Unsolved De-novo Freestyle 60

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
December 03, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


NEEEKIKKRIEEYRKRLSGMRVEIRIGQRVEIEFDGKTELRIHVHRGEEEKIKELLKEIEKVVKN

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 4 pts. 8,800
  2. Avatar for GUGITBIOTECH 12. GUGITBIOTECH 2 pts. 8,725
  3. Avatar for BOINC@Poland 13. BOINC@Poland 2 pts. 8,548
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 8,286
  5. Avatar for Deleted group 15. Deleted group pts. 8,225
  6. Avatar for Natural Abilities 16. Natural Abilities 1 pt. 8,210
  7. Avatar for Deleted group 17. Deleted group pts. 7,796
  8. Avatar for Deleted group 18. Deleted group pts. 6,855
  9. Avatar for NYIT OW BIOL-340 Fall 2015 19. NYIT OW BIOL-340 Fall 2015 1 pt. 6,420
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 6,196
  1. Avatar for gurch 51. gurch Lv 1 35 pts. 9,005
  2. Avatar for cbwest 52. cbwest Lv 1 34 pts. 8,992
  3. Avatar for isaksson 53. isaksson Lv 1 33 pts. 8,975
  4. Avatar for diamond_dust 54. diamond_dust Lv 1 32 pts. 8,975
  5. Avatar for TomTaylor 55. TomTaylor Lv 1 32 pts. 8,972
  6. Avatar for justjustin 56. justjustin Lv 1 31 pts. 8,959
  7. Avatar for uhuuhu 57. uhuuhu Lv 1 30 pts. 8,947
  8. Avatar for tarimo 58. tarimo Lv 1 30 pts. 8,945
  9. Avatar for jamiexq 59. jamiexq Lv 1 29 pts. 8,936
  10. Avatar for pauldunn 60. pauldunn Lv 1 28 pts. 8,917

Comments