Placeholder image of a protein
Icon representing a puzzle

1165: Unsolved De-novo Freestyle 60

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
December 03, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


NEEEKIKKRIEEYRKRLSGMRVEIRIGQRVEIEFDGKTELRIHVHRGEEEKIKELLKEIEKVVKN

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 4 pts. 8,800
  2. Avatar for GUGITBIOTECH 12. GUGITBIOTECH 2 pts. 8,725
  3. Avatar for BOINC@Poland 13. BOINC@Poland 2 pts. 8,548
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 8,286
  5. Avatar for Deleted group 15. Deleted group pts. 8,225
  6. Avatar for Natural Abilities 16. Natural Abilities 1 pt. 8,210
  7. Avatar for Deleted group 17. Deleted group pts. 7,796
  8. Avatar for Deleted group 18. Deleted group pts. 6,855
  9. Avatar for NYIT OW BIOL-340 Fall 2015 19. NYIT OW BIOL-340 Fall 2015 1 pt. 6,420
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 6,196
  1. Avatar for deLaCeiba 81. deLaCeiba Lv 1 16 pts. 8,789
  2. Avatar for bamh 82. bamh Lv 1 16 pts. 8,781
  3. Avatar for dizzywings 83. dizzywings Lv 1 16 pts. 8,776
  4. Avatar for Czim 84. Czim Lv 1 15 pts. 8,773
  5. Avatar for ecali 85. ecali Lv 1 15 pts. 8,770
  6. Avatar for Petrifolder 86. Petrifolder Lv 1 14 pts. 8,757
  7. Avatar for AsDawnBreaks 87. AsDawnBreaks Lv 1 14 pts. 8,736
  8. Avatar for ManVsYard 88. ManVsYard Lv 1 14 pts. 8,728
  9. Avatar for YeshuaLives 89. YeshuaLives Lv 1 13 pts. 8,727
  10. Avatar for stalluri 90. stalluri Lv 1 13 pts. 8,725

Comments