Placeholder image of a protein
Icon representing a puzzle

1165: Unsolved De-novo Freestyle 60

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
December 03, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


NEEEKIKKRIEEYRKRLSGMRVEIRIGQRVEIEFDGKTELRIHVHRGEEEKIKELLKEIEKVVKN

Top groups


  1. Avatar for CureCoin 21. CureCoin 1 pt. 6,136

  1. Avatar for fishercat 171. fishercat Lv 1 1 pt. 8,156
  2. Avatar for fpc 172. fpc Lv 1 1 pt. 8,140
  3. Avatar for SouperGenious 173. SouperGenious Lv 1 1 pt. 8,138
  4. Avatar for pandapharmd 174. pandapharmd Lv 1 1 pt. 8,098
  5. Avatar for Lindata 175. Lindata Lv 1 1 pt. 8,092
  6. Avatar for martinf 176. martinf Lv 1 1 pt. 8,005
  7. Avatar for World Emperor 177. World Emperor Lv 1 1 pt. 7,997
  8. Avatar for karost 179. karost Lv 1 1 pt. 7,941
  9. Avatar for FreeFolder 180. FreeFolder Lv 1 1 pt. 7,931

Comments