Placeholder image of a protein
Icon representing a puzzle

1165: Unsolved De-novo Freestyle 60

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
December 03, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


NEEEKIKKRIEEYRKRLSGMRVEIRIGQRVEIEFDGKTELRIHVHRGEEEKIKELLKEIEKVVKN

Top groups

  1. Avatar for CureCoin 21. CureCoin 1 pt. 6,136
  1. Avatar for inkycatz 181. inkycatz Lv 1 1 pt. 7,930
  2. Avatar for trentis1 182. trentis1 Lv 1 1 pt. 7,912
  3. Avatar for val.sch67 183. val.sch67 Lv 1 1 pt. 7,889
  4. Avatar for the1madscientist 184. the1madscientist Lv 1 1 pt. 7,888
  5. Avatar for Giant Berk 185. Giant Berk Lv 1 1 pt. 7,872
  6. Avatar for otong1 186. otong1 Lv 1 1 pt. 7,845
  7. Avatar for averagebeverage 187. averagebeverage Lv 1 1 pt. 7,838
  8. Avatar for bioinf07b 188. bioinf07b Lv 1 1 pt. 7,832
  9. Avatar for JXPZ 189. JXPZ Lv 1 1 pt. 7,824
  10. Avatar for Personifire 190. Personifire Lv 1 1 pt. 7,819

Comments