Placeholder image of a protein
Icon representing a puzzle

1165: Unsolved De-novo Freestyle 60

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
December 03, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


NEEEKIKKRIEEYRKRLSGMRVEIRIGQRVEIEFDGKTELRIHVHRGEEEKIKELLKEIEKVVKN

Top groups

  1. Avatar for CureCoin 21. CureCoin 1 pt. 6,136
  1. Avatar for teamba 201. teamba Lv 1 1 pt. 7,566
  2. Avatar for Arne Heessels 202. Arne Heessels Lv 1 1 pt. 7,551
  3. Avatar for DScott 203. DScott Lv 1 1 pt. 7,455
  4. Avatar for Skantrixx 204. Skantrixx Lv 1 1 pt. 7,362
  5. Avatar for SALiquidSilver 205. SALiquidSilver Lv 1 1 pt. 7,330
  6. Avatar for wosser1 206. wosser1 Lv 1 1 pt. 7,328
  7. Avatar for jebbiek 207. jebbiek Lv 1 1 pt. 7,288
  8. Avatar for brgreening 208. brgreening Lv 1 1 pt. 7,235
  9. Avatar for pandabearsecond 209. pandabearsecond Lv 1 1 pt. 7,223
  10. Avatar for mirjamvandelft 210. mirjamvandelft Lv 1 1 pt. 7,179

Comments