Placeholder image of a protein
Icon representing a puzzle

1165: Unsolved De-novo Freestyle 60

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
December 03, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


NEEEKIKKRIEEYRKRLSGMRVEIRIGQRVEIEFDGKTELRIHVHRGEEEKIKELLKEIEKVVKN

Top groups

  1. Avatar for CureCoin 21. CureCoin 1 pt. 6,136
  1. Avatar for larry25427 221. larry25427 Lv 1 1 pt. 6,797
  2. Avatar for Tony_G 222. Tony_G Lv 1 1 pt. 6,764
  3. Avatar for LucasPetitqueux 223. LucasPetitqueux Lv 1 1 pt. 6,609
  4. Avatar for ScienceBabe 224. ScienceBabe Lv 1 1 pt. 6,562
  5. Avatar for marie.c 225. marie.c Lv 1 1 pt. 6,443
  6. Avatar for SaDeB2015 226. SaDeB2015 Lv 1 1 pt. 6,420
  7. Avatar for tkkot 227. tkkot Lv 1 1 pt. 6,412
  8. Avatar for Fowardint 228. Fowardint Lv 1 1 pt. 6,405
  9. Avatar for Belle36 229. Belle36 Lv 1 1 pt. 6,392
  10. Avatar for AryehK 230. AryehK Lv 1 1 pt. 6,314

Comments