Placeholder image of a protein
Icon representing a puzzle

1165: Unsolved De-novo Freestyle 60

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
December 03, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


NEEEKIKKRIEEYRKRLSGMRVEIRIGQRVEIEFDGKTELRIHVHRGEEEKIKELLKEIEKVVKN

Top groups

  1. Avatar for CureCoin 21. CureCoin 1 pt. 6,136
  1. Avatar for GreekCivilization 231. GreekCivilization Lv 1 1 pt. 6,303
  2. Avatar for alexcasan 232. alexcasan Lv 1 1 pt. 6,239
  3. Avatar for PatrikStar24 233. PatrikStar24 Lv 1 1 pt. 6,232
  4. Avatar for Chen65048 234. Chen65048 Lv 1 1 pt. 6,225
  5. Avatar for Wheeler22 235. Wheeler22 Lv 1 1 pt. 6,203
  6. Avatar for aspadistra 236. aspadistra Lv 1 1 pt. 6,196
  7. Avatar for smarthuman 237. smarthuman Lv 1 1 pt. 6,136
  8. Avatar for kita_an 238. kita_an Lv 1 1 pt. 6,131
  9. Avatar for red_dr4gon1 239. red_dr4gon1 Lv 1 1 pt. 5,928
  10. Avatar for wisky 240. wisky Lv 1 1 pt. 5,927

Comments