Placeholder image of a protein
Icon representing a puzzle

1165: Unsolved De-novo Freestyle 60

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
December 03, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


NEEEKIKKRIEEYRKRLSGMRVEIRIGQRVEIEFDGKTELRIHVHRGEEEKIKELLKEIEKVVKN

Top groups

  1. Avatar for CureCoin 21. CureCoin 1 pt. 6,136
  1. Avatar for sanghun.moon 241. sanghun.moon Lv 1 1 pt. 5,927
  2. Avatar for Hakurei Reimu 242. Hakurei Reimu Lv 1 1 pt. 5,790
  3. Avatar for Mykyta 243. Mykyta Lv 1 1 pt. 5,585
  4. Avatar for YorPrints 244. YorPrints Lv 1 1 pt. 5,412
  5. Avatar for zkm 245. zkm Lv 1 1 pt. 5,135
  6. Avatar for lol 246. lol Lv 1 1 pt. 3,973
  7. Avatar for bluelzdandelion 247. bluelzdandelion Lv 1 1 pt. 3,924
  8. Avatar for KINGKONGG 248. KINGKONGG Lv 1 1 pt. 0
  9. Avatar for DarkArrow58 249. DarkArrow58 Lv 1 1 pt. 0
  10. Avatar for Satina 250. Satina Lv 1 1 pt. 0

Comments