Placeholder image of a protein
Icon representing a puzzle

1165: Unsolved De-novo Freestyle 60

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
December 03, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


NEEEKIKKRIEEYRKRLSGMRVEIRIGQRVEIEFDGKTELRIHVHRGEEEKIKELLKEIEKVVKN

Top groups

  1. Avatar for CureCoin 21. CureCoin 1 pt. 6,136
  1. Avatar for BeImmie 251. BeImmie Lv 1 1 pt. 0
  2. Avatar for dettingen 252. dettingen Lv 1 1 pt. 0
  3. Avatar for drumpeter18yrs9yrs 253. drumpeter18yrs9yrs Lv 1 1 pt. 0
  4. Avatar for packer 254. packer Lv 1 1 pt. 0
  5. Avatar for matrizona 255. matrizona Lv 1 1 pt. 0
  6. Avatar for filuis 256. filuis Lv 1 1 pt. 0
  7. Avatar for piesek75 257. piesek75 Lv 1 1 pt. 0
  8. Avatar for 20509541 258. 20509541 Lv 1 1 pt. 0
  9. Avatar for xinyu 259. xinyu Lv 1 1 pt. 0
  10. Avatar for enes1004 260. enes1004 Lv 1 1 pt. 0

Comments