Placeholder image of a protein
Icon representing a puzzle

1165: Unsolved De-novo Freestyle 60

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
December 03, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


NEEEKIKKRIEEYRKRLSGMRVEIRIGQRVEIEFDGKTELRIHVHRGEEEKIKELLKEIEKVVKN

Top groups

  1. Avatar for CureCoin 21. CureCoin 1 pt. 6,136
  1. Avatar for reefyrob 31. reefyrob Lv 1 55 pts. 9,119
  2. Avatar for Vredeman 32. Vredeman Lv 1 54 pts. 9,116
  3. Avatar for gloverd 33. gloverd Lv 1 52 pts. 9,113
  4. Avatar for steveB 34. steveB Lv 1 51 pts. 9,110
  5. Avatar for KarenCH 35. KarenCH Lv 1 50 pts. 9,104
  6. Avatar for shettler 36. shettler Lv 1 49 pts. 9,104
  7. Avatar for hpaege 37. hpaege Lv 1 48 pts. 9,102
  8. Avatar for smilingone 38. smilingone Lv 1 47 pts. 9,099
  9. Avatar for Crossed Sticks 39. Crossed Sticks Lv 1 46 pts. 9,097
  10. Avatar for Blipperman 40. Blipperman Lv 1 45 pts. 9,082

Comments