Placeholder image of a protein
Icon representing a puzzle

1165: Unsolved De-novo Freestyle 60

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
December 03, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


NEEEKIKKRIEEYRKRLSGMRVEIRIGQRVEIEFDGKTELRIHVHRGEEEKIKELLKEIEKVVKN

Top groups

  1. Avatar for CureCoin 21. CureCoin 1 pt. 6,136
  1. Avatar for gurch 51. gurch Lv 1 35 pts. 9,005
  2. Avatar for cbwest 52. cbwest Lv 1 34 pts. 8,992
  3. Avatar for isaksson 53. isaksson Lv 1 33 pts. 8,975
  4. Avatar for diamond_dust 54. diamond_dust Lv 1 32 pts. 8,975
  5. Avatar for TomTaylor 55. TomTaylor Lv 1 32 pts. 8,972
  6. Avatar for justjustin 56. justjustin Lv 1 31 pts. 8,959
  7. Avatar for uhuuhu 57. uhuuhu Lv 1 30 pts. 8,947
  8. Avatar for tarimo 58. tarimo Lv 1 30 pts. 8,945
  9. Avatar for jamiexq 59. jamiexq Lv 1 29 pts. 8,936
  10. Avatar for pauldunn 60. pauldunn Lv 1 28 pts. 8,917

Comments