Placeholder image of a protein
Icon representing a puzzle

1165: Unsolved De-novo Freestyle 60

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
December 03, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


NEEEKIKKRIEEYRKRLSGMRVEIRIGQRVEIEFDGKTELRIHVHRGEEEKIKELLKEIEKVVKN

Top groups

  1. Avatar for CureCoin 21. CureCoin 1 pt. 6,136
  1. Avatar for joremen 71. joremen Lv 1 21 pts. 8,844
  2. Avatar for goastano 72. goastano Lv 1 21 pts. 8,827
  3. Avatar for Psych0Active 73. Psych0Active Lv 1 20 pts. 8,827
  4. Avatar for crpainter 74. crpainter Lv 1 20 pts. 8,818
  5. Avatar for alcor29 75. alcor29 Lv 1 19 pts. 8,814
  6. Avatar for khalan86 76. khalan86 Lv 1 19 pts. 8,814
  7. Avatar for weitzen 77. weitzen Lv 1 18 pts. 8,810
  8. Avatar for ViJay7019 78. ViJay7019 Lv 1 18 pts. 8,807
  9. Avatar for Bushman 79. Bushman Lv 1 17 pts. 8,800
  10. Avatar for bonnellap 80. bonnellap Lv 1 17 pts. 8,792

Comments