Placeholder image of a protein
Icon representing a puzzle

1165: Unsolved De-novo Freestyle 60

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
December 03, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


NEEEKIKKRIEEYRKRLSGMRVEIRIGQRVEIEFDGKTELRIHVHRGEEEKIKELLKEIEKVVKN

Top groups

  1. Avatar for CureCoin 21. CureCoin 1 pt. 6,136
  1. Avatar for deLaCeiba 81. deLaCeiba Lv 1 16 pts. 8,789
  2. Avatar for bamh 82. bamh Lv 1 16 pts. 8,781
  3. Avatar for dizzywings 83. dizzywings Lv 1 16 pts. 8,776
  4. Avatar for Czim 84. Czim Lv 1 15 pts. 8,773
  5. Avatar for ecali 85. ecali Lv 1 15 pts. 8,770
  6. Avatar for Petrifolder 86. Petrifolder Lv 1 14 pts. 8,757
  7. Avatar for AsDawnBreaks 87. AsDawnBreaks Lv 1 14 pts. 8,736
  8. Avatar for ManVsYard 88. ManVsYard Lv 1 14 pts. 8,728
  9. Avatar for YeshuaLives 89. YeshuaLives Lv 1 13 pts. 8,727
  10. Avatar for stalluri 90. stalluri Lv 1 13 pts. 8,725

Comments