Placeholder image of a protein
Icon representing a puzzle

1165: Unsolved De-novo Freestyle 60

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
December 03, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


NEEEKIKKRIEEYRKRLSGMRVEIRIGQRVEIEFDGKTELRIHVHRGEEEKIKELLKEIEKVVKN

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,394
  2. Avatar for Contenders 2. Contenders 78 pts. 9,286
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 60 pts. 9,266
  4. Avatar for Void Crushers 4. Void Crushers 45 pts. 9,254
  5. Avatar for Gargleblasters 5. Gargleblasters 33 pts. 9,246
  6. Avatar for Go Science 6. Go Science 24 pts. 9,201
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 17 pts. 9,190
  8. Avatar for HMT heritage 8. HMT heritage 12 pts. 9,054
  9. Avatar for xkcd 9. xkcd 8 pts. 8,908
  10. Avatar for Deleted group 10. Deleted group pts. 8,903
  1. Avatar for gmn 11. gmn Lv 1 83 pts. 9,228
  2. Avatar for mimi 12. mimi Lv 1 81 pts. 9,222
  3. Avatar for grogar7 13. grogar7 Lv 1 79 pts. 9,215
  4. Avatar for dcrwheeler 14. dcrwheeler Lv 1 78 pts. 9,215
  5. Avatar for BitSpawn 15. BitSpawn Lv 1 76 pts. 9,211
  6. Avatar for bertro 16. bertro Lv 1 75 pts. 9,202
  7. Avatar for Glen B 17. Glen B Lv 1 73 pts. 9,200
  8. Avatar for aznarog 18. aznarog Lv 1 72 pts. 9,190
  9. Avatar for viosca 19. viosca Lv 1 70 pts. 9,183
  10. Avatar for frood66 20. frood66 Lv 1 69 pts. 9,173

Comments