Placeholder image of a protein
Icon representing a puzzle

1165: Unsolved De-novo Freestyle 60

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
December 03, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


NEEEKIKKRIEEYRKRLSGMRVEIRIGQRVEIEFDGKTELRIHVHRGEEEKIKELLKEIEKVVKN

Top groups


  1. Avatar for Beta Folders 100 pts. 9,394
  2. Avatar for Contenders 2. Contenders 78 pts. 9,286
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 60 pts. 9,266
  4. Avatar for Void Crushers 4. Void Crushers 45 pts. 9,254
  5. Avatar for Gargleblasters 5. Gargleblasters 33 pts. 9,246
  6. Avatar for Go Science 6. Go Science 24 pts. 9,201
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 17 pts. 9,190
  8. Avatar for HMT heritage 8. HMT heritage 12 pts. 9,054
  9. Avatar for xkcd 9. xkcd 8 pts. 8,908
  10. Avatar for Deleted group 10. Deleted group pts. 8,903

  1. Avatar for silverberg 41. silverberg Lv 1 44 pts. 9,080
  2. Avatar for Museka 42. Museka Lv 1 43 pts. 9,072
  3. Avatar for jobo0502 43. jobo0502 Lv 1 42 pts. 9,068
  4. Avatar for nicobul 44. nicobul Lv 1 41 pts. 9,060
  5. Avatar for actiasluna 45. actiasluna Lv 1 40 pts. 9,059
  6. Avatar for Bruno Kestemont 46. Bruno Kestemont Lv 1 39 pts. 9,050
  7. Avatar for O Seki To 47. O Seki To Lv 1 38 pts. 9,050
  8. Avatar for pmdpmd 48. pmdpmd Lv 1 37 pts. 9,035
  9. Avatar for guineapig 49. guineapig Lv 1 37 pts. 9,034
  10. Avatar for Mike Cassidy 50. Mike Cassidy Lv 1 36 pts. 9,033

Comments