Placeholder image of a protein
Icon representing a puzzle

1165: Unsolved De-novo Freestyle 60

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
December 03, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


NEEEKIKKRIEEYRKRLSGMRVEIRIGQRVEIEFDGKTELRIHVHRGEEEKIKELLKEIEKVVKN

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,394
  2. Avatar for Contenders 2. Contenders 78 pts. 9,286
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 60 pts. 9,266
  4. Avatar for Void Crushers 4. Void Crushers 45 pts. 9,254
  5. Avatar for Gargleblasters 5. Gargleblasters 33 pts. 9,246
  6. Avatar for Go Science 6. Go Science 24 pts. 9,201
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 17 pts. 9,190
  8. Avatar for HMT heritage 8. HMT heritage 12 pts. 9,054
  9. Avatar for xkcd 9. xkcd 8 pts. 8,908
  10. Avatar for Deleted group 10. Deleted group pts. 8,903
  1. Avatar for fryguy 61. fryguy Lv 1 27 pts. 8,908
  2. Avatar for phi16 62. phi16 Lv 1 27 pts. 8,907
  3. Avatar for Anfinsen_slept_here 63. Anfinsen_slept_here Lv 1 26 pts. 8,903
  4. Avatar for WBarme1234 64. WBarme1234 Lv 1 25 pts. 8,901
  5. Avatar for Simek 65. Simek Lv 1 25 pts. 8,900
  6. Avatar for stomjoh 66. stomjoh Lv 1 24 pts. 8,893
  7. Avatar for christioanchauvin 67. christioanchauvin Lv 1 24 pts. 8,881
  8. Avatar for egran48 68. egran48 Lv 1 23 pts. 8,877
  9. Avatar for Norrjane 69. Norrjane Lv 1 22 pts. 8,872
  10. Avatar for pvc78 70. pvc78 Lv 1 22 pts. 8,850

Comments