Placeholder image of a protein
Icon representing a puzzle

1167: Revisiting Puzzle 114: Black Mamba

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
December 09, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 4 pts. 9,540
  2. Avatar for Natural Abilities 12. Natural Abilities 2 pts. 9,193
  3. Avatar for Freedom Folders 13. Freedom Folders 2 pts. 8,910
  4. Avatar for xkcd 14. xkcd 1 pt. 8,869
  5. Avatar for NYIT OW BIOL-340 Fall 2015 15. NYIT OW BIOL-340 Fall 2015 1 pt. 8,844
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 8,681
  7. Avatar for CureCoin 17. CureCoin 1 pt. 8,656
  8. Avatar for EVHS AP Biology 18. EVHS AP Biology 1 pt. 8,644
  9. Avatar for Deleted group 19. Deleted group pts. 8,608
  10. Avatar for Team South Africa 20. Team South Africa 1 pt. 8,539
  1. Avatar for ncameron 191. ncameron Lv 1 1 pt. 8,653
  2. Avatar for Akatosh 192. Akatosh Lv 1 1 pt. 8,650
  3. Avatar for Rhyslarn 193. Rhyslarn Lv 1 1 pt. 8,649
  4. Avatar for cnhrcolemam 194. cnhrcolemam Lv 1 1 pt. 8,648
  5. Avatar for Graham MF 195. Graham MF Lv 1 1 pt. 8,646
  6. Avatar for MatthewAcosta 196. MatthewAcosta Lv 1 1 pt. 8,644
  7. Avatar for Radeodem8 197. Radeodem8 Lv 1 1 pt. 8,642
  8. Avatar for pandabearsecond 198. pandabearsecond Lv 1 1 pt. 8,640
  9. Avatar for SergiRoda 199. SergiRoda Lv 1 1 pt. 8,636
  10. Avatar for trebach 200. trebach Lv 1 1 pt. 8,634

Comments