Placeholder image of a protein
Icon representing a puzzle

1167: Revisiting Puzzle 114: Black Mamba

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
December 09, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 4 pts. 9,540
  2. Avatar for Natural Abilities 12. Natural Abilities 2 pts. 9,193
  3. Avatar for Freedom Folders 13. Freedom Folders 2 pts. 8,910
  4. Avatar for xkcd 14. xkcd 1 pt. 8,869
  5. Avatar for NYIT OW BIOL-340 Fall 2015 15. NYIT OW BIOL-340 Fall 2015 1 pt. 8,844
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 8,681
  7. Avatar for CureCoin 17. CureCoin 1 pt. 8,656
  8. Avatar for EVHS AP Biology 18. EVHS AP Biology 1 pt. 8,644
  9. Avatar for Deleted group 19. Deleted group pts. 8,608
  10. Avatar for Team South Africa 20. Team South Africa 1 pt. 8,539
  1. Avatar for goastano 71. goastano Lv 1 22 pts. 9,829
  2. Avatar for guineapig 72. guineapig Lv 1 22 pts. 9,829
  3. Avatar for Superphosphate 73. Superphosphate Lv 1 21 pts. 9,825
  4. Avatar for YeshuaLives 74. YeshuaLives Lv 1 21 pts. 9,812
  5. Avatar for Ernst Zundel 75. Ernst Zundel Lv 1 20 pts. 9,789
  6. Avatar for TomTaylor 76. TomTaylor Lv 1 20 pts. 9,785
  7. Avatar for cinnamonkitty 77. cinnamonkitty Lv 1 19 pts. 9,783
  8. Avatar for PrettyPony2001 78. PrettyPony2001 Lv 1 19 pts. 9,777
  9. Avatar for Giant Berk 79. Giant Berk Lv 1 18 pts. 9,761
  10. Avatar for TJOK fan 80. TJOK fan Lv 1 18 pts. 9,761

Comments