Placeholder image of a protein
Icon representing a puzzle

1167: Revisiting Puzzle 114: Black Mamba

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
December 09, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,241
  2. Avatar for Void Crushers 2. Void Crushers 78 pts. 10,232
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 60 pts. 10,209
  4. Avatar for Gargleblasters 4. Gargleblasters 45 pts. 10,205
  5. Avatar for Go Science 5. Go Science 33 pts. 10,197
  6. Avatar for Contenders 6. Contenders 24 pts. 10,141
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 17 pts. 10,124
  8. Avatar for HMT heritage 8. HMT heritage 12 pts. 10,097
  9. Avatar for Deleted group 9. Deleted group pts. 10,066
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 6 pts. 10,022
  1. Avatar for goastano 71. goastano Lv 1 22 pts. 9,829
  2. Avatar for guineapig 72. guineapig Lv 1 22 pts. 9,829
  3. Avatar for Superphosphate 73. Superphosphate Lv 1 21 pts. 9,825
  4. Avatar for YeshuaLives 74. YeshuaLives Lv 1 21 pts. 9,812
  5. Avatar for Ernst Zundel 75. Ernst Zundel Lv 1 20 pts. 9,789
  6. Avatar for TomTaylor 76. TomTaylor Lv 1 20 pts. 9,785
  7. Avatar for cinnamonkitty 77. cinnamonkitty Lv 1 19 pts. 9,783
  8. Avatar for PrettyPony2001 78. PrettyPony2001 Lv 1 19 pts. 9,777
  9. Avatar for Giant Berk 79. Giant Berk Lv 1 18 pts. 9,761
  10. Avatar for TJOK fan 80. TJOK fan Lv 1 18 pts. 9,761

Comments